PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015897596.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family GRAS
Protein Properties Length: 858aa    MW: 92898.1 Da    PI: 6.3281
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015897596.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS417.61.1e-1274778362374
            GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshl 96 
                      +lLl+cAeavs++++e+a+++L ++ el++p g++ qR+aayf eA++arl++s+ ++y+al+ps+ + ++ ++ ++a+++f+ +sP++kfsh+
  XP_015897596.1 477 LTLLLQCAEAVSADNFEEANKMLLEIAELSTPFGTSAQRVAAYFSEAMSARLVSSCLGIYAALSPSSVPITHIQKMASAFQVFNGISPFVKFSHF 571
                     579******************************************************************************************** PP

            GRAS  97 taNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledlel 191
                     taNqaI ea+e+eervHiiD+di+qGlQWp L++ LasRp+gpp +R+Tg+g     s ++le+tg+rL++fA++lg+pfef + va+++ +l++
  XP_015897596.1 572 TANQAIQEAFEREERVHIIDLDIMQGLQWPGLFHILASRPGGPPFVRLTGLGT----SVDALEATGKRLSDFADKLGLPFEFLP-VADKVGNLDP 661
                     *****************************************************....9**************************.7********* PP

            GRAS 192 eeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvE 286
                     ++L+v+++Ea+aV++    h+l+d ++s ++    +L+l+++l Pkvv+vveq+++h ++sFl rf+ea++yysalfdsl a++++eseer++vE
  XP_015897596.1 662 DRLNVSKREAVAVHWLQ--HSLYDVTGSDTN----TLWLLQRLAPKVVTVVEQDLSH-AGSFLGRFVEAIHYYSALFDSLGASYGEESEERHVVE 749
                     ****************9..999999999999....**********************.899********************************** PP

            GRAS 287 rellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                     ++ll+rei+nv+a  g +r  + + +++Wre+++++GF+ ++l  +aa+qa lll +++s+gy++ e+sg+l lgWkd  L+++SaWr
  XP_015897596.1 750 QQLLSREIRNVLAVGGPSRSGDVK-FHNWREKFQQCGFRGISLAGNAATQATLLLGMFPSEGYTLVEDSGTLKLGWKDLCLLTASAWR 836
                     ******************888877.**************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098561.975450816IPR005202Transcription factor GRAS
PfamPF035143.8E-125477836IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008356Biological Processasymmetric cell division
GO:0009630Biological Processgravitropism
GO:0009956Biological Processradial pattern formation
GO:0048366Biological Processleaf development
GO:0051457Biological Processmaintenance of protein location in nucleus
GO:0090610Biological Processbundle sheath cell fate specification
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 858 aa     Download sequence    Send to blast
MVRKRMASEM EVQVPTAATA TATASPITDY VRFSRRTGTV ATPNTNSSSS TTMSMMGFCF  60
PTATAAAATN ININMSMPNN SNYTNNNNNP TTTRVPTQLI SNYSTMPMLP SSANLTVLTS  120
GAGSGVLSSS PCPAANSTSP SPPPHIIDPS HPLHYHLHQV HQGSQPQPQA PAVCGFSGLP  180
LFPPETTTNS SDLPIAISAS SGGCGTRVAP MEDTCSSSSS SSATAWIDGI IKDLIHSSTD  240
VSIPQLIHNV REIIYPCNPN LAALLEYRLR SISETTFTSP SSDIRKRKEA PAPPLSVQQQ  300
QYQHQHLQQQ VQQGPNGLNK VINLDSTVNN FAIFPPPPDS CCAASASHAA THAIMNNNNN  360
NSNNNNNNNQ DLYLHWGLTV PVLPPPPSSL TPSNEQHHHH HHHHQSLDLV QQQQQPQDPQ  420
QENSSPPEEA EAEAEATATA TVAPPPSPAN ANAAILRESR KEEMRQQKRD EQGLHLLTLL  480
LQCAEAVSAD NFEEANKMLL EIAELSTPFG TSAQRVAAYF SEAMSARLVS SCLGIYAALS  540
PSSVPITHIQ KMASAFQVFN GISPFVKFSH FTANQAIQEA FEREERVHII DLDIMQGLQW  600
PGLFHILASR PGGPPFVRLT GLGTSVDALE ATGKRLSDFA DKLGLPFEFL PVADKVGNLD  660
PDRLNVSKRE AVAVHWLQHS LYDVTGSDTN TLWLLQRLAP KVVTVVEQDL SHAGSFLGRF  720
VEAIHYYSAL FDSLGASYGE ESEERHVVEQ QLLSREIRNV LAVGGPSRSG DVKFHNWREK  780
FQQCGFRGIS LAGNAATQAT LLLGMFPSEG YTLVEDSGTL KLGWKDLCLL TASAWRPPPS  840
PFHTTTAITT PTPTATLY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-494768364375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015897596.10.0PREDICTED: protein SCARECROW 2-like
SwissprotQ2Z2E90.0SCR_IPONI; Protein SCARECROW
TrEMBLM5WLC90.0M5WLC9_PRUPE; Uncharacterized protein
STRINGPOPTR_0006s11500.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20683489
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54220.10.0GRAS family protein